| Name | THOC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4764 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES |
| Purity/Format | Affinity purified |
| Blocking Peptide | THOC1 Blocking Peptide |
| Description | Rabbit polyclonal THOC1 antibody raised against the C terminal of THOC1 |
| Gene | THOC1 |
| Supplier Page | Shop |