| Name | SYNCRIP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1335 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SYNCRIP Blocking Peptide |
| Description | Rabbit polyclonal SYNCRIP antibody raised against the middle region of SYNCRIP |
| Gene | SYNCRIP |
| Supplier Page | Shop |