ATP6V0A1 antibody

Name ATP6V0A1 antibody
Supplier Fitzgerald
Catalog 70R-6858
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ATP6V0A1 antibody was raised using the N terminal of ATP6V0A1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE
Purity/Format Affinity purified
Blocking Peptide ATP6V0A1 Blocking Peptide
Description Rabbit polyclonal ATP6V0A1 antibody raised against the N terminal of ATP6V0A1
Gene ATP6V0A2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.