| Name | RBM35A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1019 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RBM35A antibody was raised using the N terminal of RBM35A corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RBM35A Blocking Peptide |
| Description | Rabbit polyclonal RBM35A antibody raised against the N terminal of RBM35A |
| Gene | ESRP1 |
| Supplier Page | Shop |