| Name | PTBP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1404 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PTBP2 Blocking Peptide |
| Description | Rabbit polyclonal PTBP2 antibody raised against the N terminal of PTBP2 |
| Gene | PTBP2 |
| Supplier Page | Shop |