FURIN antibody

Name FURIN antibody
Supplier Fitzgerald
Catalog 70R-6735
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGI
Purity/Format Affinity purified
Blocking Peptide FURIN Blocking Peptide
Description Rabbit polyclonal FURIN antibody
Gene FURIN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.