| Name | ALDOC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2334 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ALDOC Blocking Peptide |
| Description | Rabbit polyclonal ALDOC antibody raised against the N terminal of ALDOC |
| Gene | ALDH1A1 |
| Supplier Page | Shop |