| Name | PRMT1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1243 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PRMT1 Blocking Peptide |
| Description | Rabbit polyclonal PRMT1 antibody raised against the middle region of PRMT1 |
| Gene | PRMT1 |
| Supplier Page | Shop |