Name | CCBL2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4897 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CCBL2 antibody was raised using the C terminal of CCBL2 corresponding to a region with amino acids LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS |
Purity/Format | Affinity purified |
Blocking Peptide | CCBL2 Blocking Peptide |
Description | Rabbit polyclonal CCBL2 antibody raised against the C terminal of CCBL2 |
Gene | CCBL2 |
Supplier Page | Shop |