| Name | TIRAP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5827 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TIRAP antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW |
| Purity/Format | Affinity purified |
| Blocking Peptide | TIRAP Blocking Peptide |
| Description | Rabbit polyclonal TIRAP antibody |
| Gene | TIRAP |
| Supplier Page | Shop |