LSM6 antibody

Name LSM6 antibody
Supplier Fitzgerald
Catalog 70R-4929
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR
Purity/Format Affinity purified
Blocking Peptide LSM6 Blocking Peptide
Description Rabbit polyclonal LSM6 antibody
Gene LSM6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.