SPP1 antibody

Name SPP1 antibody
Supplier Fitzgerald
Catalog 70R-6095
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ
Purity/Format Affinity purified
Blocking Peptide SPP1 Blocking Peptide
Description Rabbit polyclonal SPP1 antibody
Gene SPP1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.