| Name | KIF2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5539 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KIF2A antibody was raised using the middle region of KIF2A corresponding to a region with amino acids DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF2A Blocking Peptide |
| Description | Rabbit polyclonal KIF2A antibody raised against the middle region of KIF2A |
| Gene | KIF2A |
| Supplier Page | Shop |