MARK3 antibody

Name MARK3 antibody
Supplier Fitzgerald
Catalog 70R-4449
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen MARK3 antibody was raised using the middle region of MARK3 corresponding to a region with amino acids ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD
Purity/Format Affinity purified
Blocking Peptide MARK3 Blocking Peptide
Description Rabbit polyclonal MARK3 antibody raised against the middle region of MARK3
Gene MARK3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.