Anti-GPCR GPR119 antibody
| Name | Anti-GPCR GPR119 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab75312 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-F WB ELISA ICC/IF ICC/IF IHC-P |
| Species Reactivities | Mouse, Human |
| Antigen | Synthetic peptide: KMEHAGAMAGGYRSPRTPSDFKALRTVSVL , corresponding to internal sequence amino acids 201-230 of Human GPCR GPR119 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | GPR119 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-GPCR GPR119 antibody (ab75312) at 1/500 dilutionLane 1 : extracts from K562 cellsLane 2 : extracts from K562 cells with immunising peptide at 10 µgLysates/proteins at 30 µg per lane.
Left panel: immunofluorescence analysis of MCF-7 cells, using 1/500 ab75312. Right panel: same, after pre-incubation with the immunizing peptide.