| Name | SLC47A2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2985 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SLC47A2 antibody was raised using the C terminal of SLC47A2 corresponding to a region with amino acids TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC47A2 Blocking Peptide |
| Description | Rabbit polyclonal SLC47A2 antibody raised against the C terminal of SLC47A2 |
| Gene | SLC47A2 |
| Supplier Page | Shop |