Name | UBE2O antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3984 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | UBE2O antibody was raised using the middle region of UBE2O corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR |
Purity/Format | Affinity purified |
Blocking Peptide | UBE2O Blocking Peptide |
Description | Rabbit polyclonal UBE2O antibody raised against the middle region of UBE2O |
Gene | UBE2O |
Supplier Page | Shop |