| Name | UBE2O antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3984 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UBE2O antibody was raised using the middle region of UBE2O corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBE2O Blocking Peptide |
| Description | Rabbit polyclonal UBE2O antibody raised against the middle region of UBE2O |
| Gene | UBE2O |
| Supplier Page | Shop |