| Name | PDE9A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2061 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | PDE9A antibody was raised using the N terminal of PDE9A corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDE9A Blocking Peptide |
| Description | Rabbit polyclonal PDE9A antibody raised against the N terminal of PDE9A |
| Gene | PDE9A |
| Supplier Page | Shop |