PPM1A antibody

Name PPM1A antibody
Supplier Fitzgerald
Catalog 70R-5788
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PPM1A antibody was raised using a synthetic peptide corresponding to a region with amino acids EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK
Purity/Format Affinity purified
Blocking Peptide PPM1A Blocking Peptide
Description Rabbit polyclonal PPM1A antibody
Gene PPM1A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.