| Name | Optineurin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2621 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII |
| Purity/Format | Affinity purified |
| Blocking Peptide | Optineurin Blocking Peptide |
| Description | Rabbit polyclonal Optineurin antibody raised against the C terminal of OPTN |
| Gene | OPTN |
| Supplier Page | Shop |