FBXO4 antibody

Name FBXO4 antibody
Supplier Fitzgerald
Catalog 70R-2791
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK
Purity/Format Affinity purified
Blocking Peptide FBXO4 Blocking Peptide
Description Rabbit polyclonal FBXO4 antibody raised against the middle region of FBXO4
Gene FBXO4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.