Name | DOCK2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5803 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA |
Purity/Format | Affinity purified |
Blocking Peptide | DOCK2 Blocking Peptide |
Description | Rabbit polyclonal DOCK2 antibody raised against the middle region of DOCK2 |
Gene | DOCK2 |
Supplier Page | Shop |