| Name | DOCK2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5803 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | DOCK2 Blocking Peptide |
| Description | Rabbit polyclonal DOCK2 antibody raised against the middle region of DOCK2 |
| Gene | DOCK2 |
| Supplier Page | Shop |