| Name | CACYBP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1064 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | CACYBP antibody was raised using the middle region of CACYBP corresponding to a region with amino acids FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CACYBP Blocking Peptide |
| Description | Rabbit polyclonal CACYBP antibody raised against the middle region of CACYBP |
| Gene | CACYBP |
| Supplier Page | Shop |