| Name | FANCL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3410 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY |
| Purity/Format | Affinity purified |
| Blocking Peptide | FANCL Blocking Peptide |
| Description | Rabbit polyclonal FANCL antibody raised against the middle region of FANCL |
| Gene | FANCL |
| Supplier Page | Shop |