| Name | CHIA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5921 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CHIA antibody was raised using the middle region of CHIA corresponding to a region with amino acids GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP |
| Purity/Format | Affinity purified |
| Blocking Peptide | CHIA Blocking Peptide |
| Description | Rabbit polyclonal CHIA antibody raised against the middle region of CHIA |
| Gene | CHIA |
| Supplier Page | Shop |