| Name | Cornulin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4583 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Cornulin antibody was raised using the middle region of CRNN corresponding to a region with amino acids GDRQPTVVGEEWVDDHSRETVILRLDQGNLHTSVSSAQGQDAAQSEEKRG |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cornulin Blocking Peptide |
| Description | Rabbit polyclonal Cornulin antibody raised against the middle region of CRNN |
| Gene | CRNN |
| Supplier Page | Shop |