| Name | LYK5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2094 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV |
| Purity/Format | Affinity purified |
| Blocking Peptide | LYK5 Blocking Peptide |
| Description | Rabbit polyclonal LYK5 antibody raised against the C terminal of LYK5 |
| Gene | STRADA |
| Supplier Page | Shop |