DDX5 antibody

Name DDX5 antibody
Supplier Fitzgerald
Catalog 70R-1398
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen DDX5 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY
Purity/Format Total IgG Protein A purified
Blocking Peptide DDX5 Blocking Peptide
Description Rabbit polyclonal DDX5 antibody
Gene DDX5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.