SHB antibody

Name SHB antibody
Supplier Fitzgerald
Catalog 70R-5789
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA
Purity/Format Affinity purified
Blocking Peptide SHB Blocking Peptide
Description Rabbit polyclonal SHB antibody raised against the N terminal of SHB
Gene SHB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.