| Name | SNRPB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4699 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SNRPB antibody was raised using the N terminal of SNRPB corresponding to a region with amino acids DKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEG |
| Purity/Format | Affinity purified |
| Blocking Peptide | SNRPB Blocking Peptide |
| Description | Rabbit polyclonal SNRPB antibody raised against the N terminal of SNRPB |
| Gene | SNRPB |
| Supplier Page | Shop |