| Name | TFAM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1944 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TFAM antibody was raised using the middle region of TFAM corresponding to a region with amino acids LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI |
| Purity/Format | Affinity purified |
| Blocking Peptide | TFAM Blocking Peptide |
| Description | Rabbit polyclonal TFAM antibody raised against the middle region of TFAM |
| Gene | TFAM |
| Supplier Page | Shop |