| Name | Cyclin Y antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5501 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cyclin Y Blocking Peptide |
| Description | Rabbit polyclonal Cyclin Y antibody raised against the middle region of CCNY |
| Gene | CCNY |
| Supplier Page | Shop |