| Name | Serglycin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5024 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY |
| Purity/Format | Affinity purified |
| Blocking Peptide | Serglycin Blocking Peptide |
| Description | Rabbit polyclonal Serglycin antibody raised against the middle region of SRGN |
| Gene | SRGN |
| Supplier Page | Shop |