| Name | CD8B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5988 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
| Purity/Format | Affinity purified |
| Blocking Peptide | CD8B Blocking Peptide |
| Description | Rabbit polyclonal CD8B antibody raised against the N terminal of CD8B |
| Gene | CD8B |
| Supplier Page | Shop |