| Name | SNRPA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4992 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SNRPA antibody was raised using the middle region of SNRPA corresponding to a region with amino acids MPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV |
| Purity/Format | Affinity purified |
| Blocking Peptide | SNRPA Blocking Peptide |
| Description | Rabbit polyclonal SNRPA antibody raised against the middle region of SNRPA |
| Gene | SNRPA |
| Supplier Page | Shop |