| Name | HNF4G antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1917 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HNF4G antibody was raised using the N terminal of HNF4G corresponding to a region with amino acids MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNF4G Blocking Peptide |
| Description | Rabbit polyclonal HNF4G antibody raised against the N terminal of HNF4G |
| Gene | HNF4A |
| Supplier Page | Shop |