| Name | TSHR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2915 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TSHR antibody was raised using the C terminal of TSHR corresponding to a region with amino acids KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | TSHR Blocking Peptide |
| Description | Rabbit polyclonal TSHR antibody raised against the C terminal of TSHR |
| Gene | TSHR |
| Supplier Page | Shop |