| Name | RABL4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5863 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RABL4 Blocking Peptide |
| Description | Rabbit polyclonal RABL4 antibody raised against the C terminal of RABL4 |
| Gene | IFT27 |
| Supplier Page | Shop |