| Name | TRPM4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5157 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TRPM4 antibody was raised using the N terminal of TRPM4 corresponding to a region with amino acids ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRPM4 Blocking Peptide |
| Description | Rabbit polyclonal TRPM4 antibody raised against the N terminal of TRPM4 |
| Gene | TRPM4 |
| Supplier Page | Shop |