| Name | XTP3TPA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1225 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | XTP3TPA antibody was raised using the N terminal of XTP3TPA corresponding to a region with amino acids MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | XTP3TPA Blocking Peptide |
| Description | Rabbit polyclonal XTP3TPA antibody raised against the N terminal of XTP3TPA |
| Gene | DCTPP1 |
| Supplier Page | Shop |