| Name | PRKAB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3695 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRKAB1 Blocking Peptide |
| Description | Rabbit polyclonal PRKAB1 antibody raised against the N terminal of PRKAB1 |
| Gene | PRKAB1 |
| Supplier Page | Shop |