| Name | THEX1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4623 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | THEX1 antibody was raised using the N terminal of theX1 corresponding to a region with amino acids EPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGCINR |
| Purity/Format | Affinity purified |
| Blocking Peptide | THEX1 Blocking Peptide |
| Description | Rabbit polyclonal THEX1 antibody raised against the N terminal of theX1 |
| Gene | ERI1 |
| Supplier Page | Shop |