| Name | AP3M2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3582 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | AP3M2 antibody was raised using the middle region of AP3M2 corresponding to a region with amino acids VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID |
| Purity/Format | Affinity purified |
| Blocking Peptide | AP3M2 Blocking Peptide |
| Description | Rabbit polyclonal AP3M2 antibody raised against the middle region of AP3M2 |
| Gene | AP3M2 |
| Supplier Page | Shop |