| Name | CUGBP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4862 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT |
| Purity/Format | Affinity purified |
| Blocking Peptide | CUGBP1 Blocking Peptide |
| Description | Rabbit polyclonal CUGBP1 antibody raised against the N terminal of CUGBP1 |
| Gene | CELF1 |
| Supplier Page | Shop |