| Name | LRRC50 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3357 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC50 Blocking Peptide |
| Description | Rabbit polyclonal LRRC50 antibody raised against the N terminal of LRRC50 |
| Gene | DNAAF1 |
| Supplier Page | Shop |