| Name | ApoBEC3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4926 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ApoBEC3B antibody was raised using the N terminal of APOBEC3B corresponding to a region with amino acids NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW |
| Purity/Format | Affinity purified |
| Blocking Peptide | ApoBEC3B Blocking Peptide |
| Description | Rabbit polyclonal ApoBEC3B antibody raised against the N terminal of APOBEC3B |
| Gene | APOBEC3B |
| Supplier Page | Shop |