OSGEP antibody

Name OSGEP antibody
Supplier Fitzgerald
Catalog 70R-3838
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGA
Purity/Format Affinity purified
Blocking Peptide OSGEP Blocking Peptide
Description Rabbit polyclonal OSGEP antibody raised against the N terminal of OSGEP
Gene OSGEP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.