TMEM30B antibody

Name TMEM30B antibody
Supplier Fitzgerald
Catalog 70R-6444
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TMEM30B antibody was raised using the middle region of TMEM30B corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL
Purity/Format Affinity purified
Blocking Peptide TMEM30B Blocking Peptide
Description Rabbit polyclonal TMEM30B antibody raised against the middle region of TMEM30B
Gene TMEM30B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.