| Name | EMP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1915 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | EMP2 Blocking Peptide |
| Description | Rabbit polyclonal EMP2 antibody raised against the middle region of EMP2 |
| Gene | EMP2 |
| Supplier Page | Shop |