Transportin 2 antibody

Name Transportin 2 antibody
Supplier Fitzgerald
Catalog 70R-2016
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA
Purity/Format Affinity purified
Blocking Peptide Transportin 2 Blocking Peptide
Description Rabbit polyclonal Transportin 2 antibody
Gene TNPO2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.